Favicon of rano-androy.org Rano-androy.org ARA Association Rano Androy, Madagascar

L'Association Rano Androy A.R.A. a été créée le 19 mai 2016 et est enregistrée sous le numéro W9R1005171 auprès de la préfecture de La Réunion (FR 97400)

Keywords: Madagascar Androy Eau Agriculture Sud Aride Famine Kere Kéré Sécheresse Reboisement Agroforesterie Lavanono Lémurien Tortue

Visit Site

About rano-androy.org

The domain name has registered. TLD (Top level domain) of the domain name is org and SLD (Second level domain) length equals to 11.. it's too long. A human-memoribility domain name length should be maximum chars of 9 as well as brand-friendly. Domain name choosing is important to maximize search engine-referred traffic.

rano-androy.org was created by Frederic SALLEY on 07/07/2016 . For further raw whois information please take a look at the Whois section.

rano-androy.org's A record assigned to . if you want to see such as Name Server, CNAME, MX etc. please look at the DNS section. More rano-androy.org DNS information may be found in

Last Reload: 22 days ago

IP Address:
Country: France (FR)
Page Speed: 41%
Created Date: 07-07-2016
Updated Date: 06-09-2016
Expired Date: 07-07-2017
Meta Title: ARA Association Rano Androy, Madagascar
Meta Description: L'Association Rano Androy A.R.A. a été créée le 19 mai 2016 et est enregistrée sous le numéro W9R1005171 auprès de la préfecture de La Réunion (FR 97400)
Meta Keywords: Madagascar Androy Eau Agriculture Sud Aride Famine Kere Kéré Sécheresse Reboisement Agroforesterie Lavanono Lémurien Tortue

Server Location

Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service found where is host rano-androy.org . Currently, hosted in France and its service provider is Online S.a.s. .

Latitude: 48.8582
Longitude: 2.3387
Timezone: Europe/Paris
Country: France (FR)

DNS Records

Basicly, DNS (Domain Name System) is a system that converts human-readable website names into computer-readable numeric IP addresses. Example, A record indicates you which ip address will resolve when you access to rano-androy.org on the browser.

Host Type TTL Class Other
rano-androy.org. NS 86400 IN ns2.frianbiz.com.
rano-androy.org. NS 86400 IN ns1.frianbiz.com.
rano-androy.org. MX 86400 IN 10 mx1.asso-web.com.
rano-androy.org. SOA 86400 IN ns1.frianbiz.com. hostmaster.frianbiz.com. 2016070700 28800 7200 604800 86400
rano-androy.org. MX 86400 IN 20 mx2.asso-web.com.
rano-androy.org. A 86400 IN

Heading Analysis

Espace securisé
L’École Primaire Publique de Lavanono
Photos et Vidéos
Rechercher sur le site
Livre d'or
Espace membre
Accés protégé
Le Village de Lavanono
Le Village de Lavanono
Le Village de Lavanono
Photos de notre parcelle
Photos de notre parcelle
Pas encore de message sur le livre d'or

Whois Information

Whois is a protocol that is access to registering information. You can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations. In a nutshell, it includes these informations;

  • The domain registered by OVH .
  • rano-androy.org taken by Frederic SALLEY on 07/07/2016 and it will expire on 07/07/2017 .
  • Its name servers are; ns2.frianbiz.com. ns1.frianbiz.com.

Registrar Name: OVH
Registrant Name: Frederic SALLEY
Registrant Organization: SARL Frianbiz
Created Date: Thursday, July 7th, 2016
Updated Date: Tuesday, September 6th, 2016
Expires Date: Friday, July 7th, 2017
Admin Name: Frederic SALLEY
Admin Organization: SARL Frianbiz
Technical Name: Frederic SALLEY
Technical Organization: SARL Frianbiz

HTTP Header Analysis

HTTP Header information is a part of HTTP protocol that a user's browser sends to a Web Server containing the details of what the browser wants and will accept back from the web server.

Status-Code: 200
Response Time: 1175
Date Fri, 25 Nov 2016 13:20:22 GMT
Set-Cookie PHPSESSID=8s5s5ngdcvhvr41tqu56bqj523; path=/
Expires Thu, 19 Nov 1981 08:52:00 GMT
Vary Accept-Encoding
Content-Encoding gzip
Content-Type text/html
Transfer-Encoding chunked
Connection keep-alive
Accept-Ranges bytes
Go to top

Reverse Ip

Websites hosted with the same IP Address

Favicon of grslemeesports.com Grslemeesports.com GRS LE MEE SPORTS
Favicon of urosro.fr Urosro.fr Union des Retraités des Organismes Sociaux de la Région d'Orléans (U.R...
Favicon of planetemajeunesse.com Planetemajeunesse.com Frianbiz
Favicon of justicevictimesroute.fr Justicevictimesroute.fr Association Collectif Justice Pour LesVictimes De La Route
Favicon of lisy.fr Lisy.fr Bibliothèque numérique à la demande LISY (Lire sans les Yeux)
Favicon of cdsa75.fr Cdsa75.fr Comité Départemental Sport Adapté de Paris
Favicon of camping-car-club-sud.com Camping-car-club-sud.com CAMPING CAR CLUB SUD
Favicon of lanesquepropre.com Lanesquepropre.com La Nesque Propre
Favicon of association.fr Association.fr Association.fr, Annuaire associatif, agenda et dossiers pratiques
Favicon of maisoneuropeauvergne.com Maisoneuropeauvergne.com
More >>

Reverse Whois

Websites which registered with the same Owner.

Favicon of justicevictimesroute.fr Justicevictimesroute.fr Association Collectif Justice Pour LesVictimes De La Route
Favicon of cdsa75.fr Cdsa75.fr Comité Départemental Sport Adapté de Paris
Favicon of mondioring2015.fr Mondioring2015.fr MONDIORING 2015
Favicon of lelivrevivant.fr Lelivrevivant.fr Le livre vivant
Favicon of venisseuxolympiquedansesportive.fr Venisseuxolympiquedansesportive.fr LYON METROPOLE DANSE SPORTIVE
Favicon of ahge-association.org Ahge-association.org Association des handicapés de Goudiri et Environnants
Favicon of colomiers-retraite-active.fr Colomiers-retraite-active.fr COLOMIERS RETRAITE ACTIVE
Favicon of comitedeloireatlantiquedecyclisme.fr Comitedeloireatlantiquedecyclisme.fr FFC Comité Départemental de Loire Atlantique
Favicon of championnatfranceavenircyclismelespieux2015.fr Championnatfranceavenircyclismelespieux2015.fr Comité d'Organisation des Championnats de France de l'Avenir 2015
Favicon of arpd-idf.org Arpd-idf.org
More >>


The following list shows you to spelling mistakes possible of the internet users for the website searched rano-androy.org.

  • www.ano-androy.org
  • www.rrano-androy.org
  • www.4ano-androy.org
  • www.4rano-androy.org
  • www.r4ano-androy.org
  • www.dano-androy.org
  • www.drano-androy.org
  • www.rdano-androy.org
  • www.gano-androy.org
  • www.grano-androy.org
  • www.rgano-androy.org
  • www.eano-androy.org
  • www.erano-androy.org
  • www.reano-androy.org
  • www.tano-androy.org
  • www.trano-androy.org
  • www.rtano-androy.org
  • www.fano-androy.org
  • www.frano-androy.org
  • www.rfano-androy.org
  • www.5ano-androy.org
  • www.5rano-androy.org
  • www.r5ano-androy.org
  • www.rno-androy.org
  • www.raano-androy.org
  • www.rwno-androy.org
  • www.rwano-androy.org
  • www.rawno-androy.org
  • www.rzno-androy.org
  • www.rzano-androy.org
  • www.razno-androy.org
  • www.rsno-androy.org
  • www.rsano-androy.org
  • www.rasno-androy.org
  • www.rqno-androy.org
  • www.rqano-androy.org
  • www.raqno-androy.org
  • www.arno-androy.org
  • www.rao-androy.org
  • www.ranno-androy.org
  • www.rabo-androy.org
  • www.rabno-androy.org
  • www.ranbo-androy.org
  • www.ra o-androy.org
  • www.ra no-androy.org
  • www.ran o-androy.org
  • www.rako-androy.org
  • www.rakno-androy.org
  • www.ranko-androy.org
  • www.ramo-androy.org
  • www.ramno-androy.org
  • www.ranmo-androy.org
  • www.raho-androy.org
  • www.rahno-androy.org
  • www.ranho-androy.org
  • www.rajo-androy.org
  • www.rajno-androy.org
  • www.ranjo-androy.org
  • www.rnao-androy.org
  • www.ran-androy.org
  • www.ranoo-androy.org
  • www.ranp-androy.org
  • www.ranpo-androy.org
  • www.ranop-androy.org
  • www.rani-androy.org
  • www.ranio-androy.org
  • www.ranoi-androy.org
  • www.rank-androy.org
  • www.ranko-androy.org
  • www.ranok-androy.org
  • www.ranl-androy.org
  • www.ranlo-androy.org
  • www.ranol-androy.org
  • www.ran0-androy.org
  • www.ran0o-androy.org
  • www.rano0-androy.org
  • www.ran:-androy.org
  • www.ran:o-androy.org
  • www.rano:-androy.org
  • www.ran9-androy.org
  • www.ran9o-androy.org
  • www.rano9-androy.org
  • www.raon-androy.org
  • www.rano-ndroy.org
  • www.rano-aandroy.org
  • www.rano-wndroy.org
  • www.rano-wandroy.org
  • www.rano-awndroy.org
  • www.rano-zndroy.org
  • www.rano-zandroy.org
  • www.rano-azndroy.org
  • www.rano-sndroy.org
  • www.rano-sandroy.org
  • www.rano-asndroy.org
  • www.rano-qndroy.org
  • www.rano-qandroy.org
  • www.rano-aqndroy.org
  • www.ranoa-ndroy.org
  • www.rano-adroy.org
  • www.rano-anndroy.org
  • www.rano-abdroy.org
  • www.rano-abndroy.org
  • www.rano-anbdroy.org
  • www.rano-a droy.org
  • www.rano-a ndroy.org
  • www.rano-an droy.org
  • www.rano-akdroy.org
  • www.rano-akndroy.org
  • www.rano-ankdroy.org
  • www.rano-amdroy.org
  • www.rano-amndroy.org
  • www.rano-anmdroy.org
  • www.rano-ahdroy.org
  • www.rano-ahndroy.org
  • www.rano-anhdroy.org
  • www.rano-ajdroy.org
  • www.rano-ajndroy.org
  • www.rano-anjdroy.org
  • www.rano-nadroy.org
  • www.rano-anroy.org
  • www.rano-anddroy.org
  • www.rano-ansroy.org
  • www.rano-ansdroy.org
  • www.rano-andsroy.org
  • www.rano-anrroy.org
  • www.rano-anrdroy.org
  • www.rano-andrroy.org
  • www.rano-anxroy.org
  • www.rano-anxdroy.org
  • www.rano-andxroy.org
  • www.rano-ancroy.org
  • www.rano-ancdroy.org
  • www.rano-andcroy.org
  • www.rano-aneroy.org
  • www.rano-anedroy.org
  • www.rano-anderoy.org
  • www.rano-anfroy.org
  • www.rano-anfdroy.org
  • www.rano-andfroy.org
  • www.rano-adnroy.org
  • www.rano-andoy.org
  • www.rano-andrroy.org
  • www.rano-and4oy.org
  • www.rano-and4roy.org
  • www.rano-andr4oy.org
  • www.rano-anddoy.org
  • www.rano-anddroy.org
  • www.rano-andrdoy.org
  • www.rano-andgoy.org
  • www.rano-andgroy.org
  • www.rano-andrgoy.org
  • www.rano-andeoy.org
  • www.rano-anderoy.org
  • www.rano-andreoy.org
  • www.rano-andtoy.org
  • www.rano-andtroy.org
  • www.rano-andrtoy.org
  • www.rano-andfoy.org
  • www.rano-andfroy.org
  • www.rano-andrfoy.org
  • www.rano-and5oy.org
  • www.rano-and5roy.org
  • www.rano-andr5oy.org
  • www.rano-anrdoy.org
  • www.rano-andry.org
  • www.rano-androoy.org
  • www.rano-andrpy.org
  • www.rano-andrpoy.org
  • www.rano-andropy.org
  • www.rano-andriy.org
  • www.rano-andrioy.org
  • www.rano-androiy.org
  • www.rano-andrky.org
  • www.rano-andrkoy.org
  • www.rano-androky.org
  • www.rano-andrly.org
  • www.rano-andrloy.org
  • www.rano-androly.org
  • www.rano-andr0y.org
  • www.rano-andr0oy.org
  • www.rano-andro0y.org
  • www.rano-andr:y.org
  • www.rano-andr:oy.org
  • www.rano-andro:y.org
  • www.rano-andr9y.org
  • www.rano-andr9oy.org
  • www.rano-andro9y.org
  • www.rano-andory.org
  • www.rano-andro.org
  • www.rano-androyy.org
  • www.rano-andro7.org
  • www.rano-andro7y.org
  • www.rano-androy7.org
  • www.rano-androg.org
  • www.rano-androgy.org
  • www.rano-androyg.org
  • www.rano-androj.org
  • www.rano-androjy.org
  • www.rano-androyj.org
  • www.rano-androh.org
  • www.rano-androhy.org
  • www.rano-androyh.org
  • www.rano-androt.org
  • www.rano-androty.org
  • www.rano-androyt.org
  • www.rano-androu.org
  • www.rano-androuy.org
  • www.rano-androyu.org
  • www.rano-andro6.org
  • www.rano-andro6y.org
  • www.rano-androy6.org
  • www.rano-andryo.org
  • www.rano-androyorg
  • www.rano-androy..org
  • www.rano-androy/org
  • www.rano-androy/.org
  • www.rano-androy./org
  • www.rano-androynorg
  • www.rano-androyn.org
  • www.rano-androy.norg
  • www.rano-androy;org
  • www.rano-androy;.org
  • www.rano-androy.;org
  • www.rano-androylorg
  • www.rano-androyl.org
  • www.rano-androy.lorg
  • www.rano-androy org
  • www.rano-androy .org
  • www.rano-androy. org
  • www.rano-androy,org
  • www.rano-androy,.org
  • www.rano-androy.,org
  • www.rano-androymorg
  • www.rano-androym.org
  • www.rano-androy.morg
  • www.rano-andro.yorg
  • www.rano-androy.rg
  • www.rano-androy.oorg
  • www.rano-androy.prg
  • www.rano-androy.porg
  • www.rano-androy.oprg
  • www.rano-androy.irg
  • www.rano-androy.iorg
  • www.rano-androy.oirg
  • www.rano-androy.krg
  • www.rano-androy.korg
  • www.rano-androy.okrg
  • www.rano-androy.lrg
  • www.rano-androy.lorg
  • www.rano-androy.olrg
  • www.rano-androy.0rg
  • www.rano-androy.0org
  • www.rano-androy.o0rg
  • www.rano-androy.:rg
  • www.rano-androy.:org
  • www.rano-androy.o:rg
  • www.rano-androy.9rg
  • www.rano-androy.9org
  • www.rano-androy.o9rg
  • www.rano-androyo.rg
  • www.rano-androy.og
  • www.rano-androy.orrg
  • www.rano-androy.o4g
  • www.rano-androy.o4rg
  • www.rano-androy.or4g
  • www.rano-androy.odg
  • www.rano-androy.odrg
  • www.rano-androy.ordg
  • www.rano-androy.ogg
  • www.rano-androy.ogrg
  • www.rano-androy.orgg
  • www.rano-androy.oeg
  • www.rano-androy.oerg
  • www.rano-androy.oreg
  • www.rano-androy.otg
  • www.rano-androy.otrg
  • www.rano-androy.ortg
  • www.rano-androy.ofg
  • www.rano-androy.ofrg
  • www.rano-androy.orfg
  • www.rano-androy.o5g
  • www.rano-androy.o5rg
  • www.rano-androy.or5g
  • www.rano-androy.rog
  • www.rano-androy.or
  • www.rano-androy.orgg
  • www.rano-androy.ory
  • www.rano-androy.oryg
  • www.rano-androy.orgy
  • www.rano-androy.orr
  • www.rano-androy.orrg
  • www.rano-androy.orgr
  • www.rano-androy.orh
  • www.rano-androy.orhg
  • www.rano-androy.orgh
  • www.rano-androy.orf
  • www.rano-androy.orfg
  • www.rano-androy.orgf
  • www.rano-androy.ort
  • www.rano-androy.ortg
  • www.rano-androy.orgt
  • www.rano-androy.orv
  • www.rano-androy.orvg
  • www.rano-androy.orgv
  • www.rano-androy.orb
  • www.rano-androy.orbg
  • www.rano-androy.orgb
  • www.rano-androy.ogr
Show All Mistakes Hide All Mistakes